PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462908680
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family HB-other
Protein Properties Length: 169aa    MW: 18658.2 Da    PI: 4.3835
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462908680genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.68.9e-0868107443
                -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHH CS
   Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterq 43 
                ++++  +q+++Le++Fe +++++ +++ ++A+ lgL+ rq
  462908680  68 KRRLALDQVRALERCFETDNKLDPDRKSRIARDLGLQPRQ 107
                4467789******************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.72E-661107IPR009057Homeodomain-like
CDDcd000866.23E-767107No hitNo description
PfamPF000465.1E-568107IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-774107IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MKRQSKRPTR SHESTEQGDK LAFADEEPLT ARNMDHDDQA EMDDVDDDDD EVAGGRAAPS  60
SCGLGEKKRR LALDQVRALE RCFETDNKLD PDRKSRIARD LGLQPRQWPH GSTYPSDSYK  120
CGGSYGFTEE WLAGSDVIGN VDGAAGFFPD EHASSLNFGW CASGAEGWD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX4699251e-62JX469925.1 Zea mays subsp. mays clone UT3181 HB-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985408.12e-39PREDICTED: homeobox-leucine zipper protein HOX13-like
SwissprotA2XDD63e-27HOX13_ORYSI; Homeobox-leucine zipper protein HOX13
TrEMBLA0A0A9PIJ14e-44A0A0A9PIJ1_ARUDO; Uncharacterized protein
STRINGSi036724m5e-39(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.14e-16homeobox protein 16